PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_7BL_5C24556B6.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family NF-YC
Protein Properties Length: 105aa    MW: 11662.4 Da    PI: 5.0786
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_7BL_5C24556B6.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC993.7e-3117230101
                  NF-YC  30 lkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivprdel 101
                            ++ad+dv+misaeaP+l++kace+f le+t rsw+ ++e kr  l++sd+aaav+rtdi+dfl+d    +e+
  Traes_7BL_5C24556B6.1   1 MRADQDVHMISAEAPALFAKACEMFTLEMTKRSWMVTKEDKRGVLQRSDVAAAVARTDIYDFLLDLFTSEET 72 
                            89***************************************************************9988875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.104.2E-23166IPR009072Histone-fold
SuperFamilySSF471132.68E-20167IPR009072Histone-fold
PfamPF008081.0E-10154IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 105 aa     Download sequence    Send to blast
MRADQDVHMI SAEAPALFAK ACEMFTLEMT KRSWMVTKED KRGVLQRSDV AAAVARTDIY  60
DFLLDLFTSE ETKQGVLLPR TGQQPMGAPT GAYPYCYAPQ QQVAG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_C3e-2216651116HapE
4g92_C3e-2216651116HapE
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001136950.12e-43uncharacterized protein LOC100217109
SwissprotQ8L4B21e-32NFYC9_ARATH; Nuclear transcription factor Y subunit C-9
TrEMBLW5HMI44e-74W5HMI4_WHEAT; Uncharacterized protein
STRINGGRMZM2G124421_P018e-43(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP157031216
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08970.46e-34nuclear factor Y, subunit C9
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]